PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.MXV1S
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family bHLH
Protein Properties Length: 103aa    MW: 11450 Da    PI: 8.2012
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.MXV1SgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH27.74.9e-0920591554
                 HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
          HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                 +i +  ++L++l+P++ +++s K+s a +L++++ YIk L
  Aradu.MXV1S 20 QITDLVSKLQQLIPQLRSTHSDKVSAAKVLQETCTYIKTL 59
                 6889999********879********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508889.172559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.75E-92082IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.8E-82075IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.5E-62059IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 103 aa     Download sequence    Send to blast
MSTRRSSSAA PTSAGMTDAQ ITDLVSKLQQ LIPQLRSTHS DKVSAAKVLQ ETCTYIKTLH  60
REVDDLSDRL SQLLANTDSN TAQAAIIRSL LMCYYYYIIN YSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956865.11e-59PREDICTED: transcription factor PRE6-like
SwissprotQ8GW322e-36PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A0L9TLK32e-44A0A0L9TLK3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R1V62e-44A0A0S3R1V6_PHAAN; Uncharacterized protein
STRINGGLYMA02G02250.18e-43(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF56734143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-37bHLH family protein